TCEB2 Antibody (2B4)

Images

 
Sandwich ELISA: TCEB2 Antibody (2B4) [H00006923-M03] - Detection limit for recombinant GST tagged TCEB2 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCEB2 Antibody (2B4) Summary

Immunogen
TCEB2 (AAH13306, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Specificity
TCEB2 - transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) (2B4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ELOB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCEB2 Antibody (2B4)

  • 18-kD subunit
  • EloB
  • Elongin 18 kDa subunit
  • elongin-B
  • RNA polymerase II transcription factor SIII p18 subunit
  • RNA polymerase II transcription factor SIII subunit B
  • SIII p18
  • transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
  • transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
  • transcription elongation factor B polypeptide 2

Background

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87581
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-45210
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-87040
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
Applications: WB
NBP2-00612
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-20380
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TCEB2 Antibody (H00006923-M03) (0)

There are no publications for TCEB2 Antibody (H00006923-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEB2 Antibody (H00006923-M03) (0)

There are no reviews for TCEB2 Antibody (H00006923-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCEB2 Antibody (H00006923-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCEB2 Products

Bioinformatics Tool for TCEB2 Antibody (H00006923-M03)

Discover related pathways, diseases and genes to TCEB2 Antibody (H00006923-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCEB2 Antibody (H00006923-M03)

Discover more about diseases related to TCEB2 Antibody (H00006923-M03).
 

Pathways for TCEB2 Antibody (H00006923-M03)

View related products by pathway.

PTMs for TCEB2 Antibody (H00006923-M03)

Learn more about PTMs related to TCEB2 Antibody (H00006923-M03).
 

Research Areas for TCEB2 Antibody (H00006923-M03)

Find related products by research area.

Blogs on TCEB2

There are no specific blogs for TCEB2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEB2 Antibody (2B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ELOB
Entrez
Uniprot