Recombinant Human TBLR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TBLR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-102 of Human TBL1XR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNIVAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYSFQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TBL1XR1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBLR1 Protein

  • C21
  • DC42
  • F-box-like/WD repeat-containing protein TBL1XR1
  • FLJ12894
  • IRA1Transducin beta-like 1X-related protein 1
  • Nuclear receptor corepressor/HDAC3 complex subunit TBLR1
  • nuclear receptor co-repressor/HDAC3 complex subunit
  • TBLR1TBL1-related protein 1
  • transducin (beta)-like 1 X-linked receptor 1
  • transducin (beta)-like 1X-linked receptor 1

Background

The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-872
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
H00079718-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TBLR1 Recombinant Protein (H00079718-P01) (0)

There are no publications for TBLR1 Recombinant Protein (H00079718-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBLR1 Recombinant Protein (H00079718-P01) (0)

There are no reviews for TBLR1 Recombinant Protein (H00079718-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBLR1 Recombinant Protein (H00079718-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBLR1 Products

Bioinformatics Tool for TBLR1 Recombinant Protein (H00079718-P01)

Discover related pathways, diseases and genes to TBLR1 Recombinant Protein (H00079718-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBLR1 Recombinant Protein (H00079718-P01)

Discover more about diseases related to TBLR1 Recombinant Protein (H00079718-P01).
 

Pathways for TBLR1 Recombinant Protein (H00079718-P01)

View related products by pathway.

PTMs for TBLR1 Recombinant Protein (H00079718-P01)

Learn more about PTMs related to TBLR1 Recombinant Protein (H00079718-P01).
 

Research Areas for TBLR1 Recombinant Protein (H00079718-P01)

Find related products by research area.

Blogs on TBLR1

There are no specific blogs for TBLR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TBLR1 Antibody
NB600-270

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBLR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBL1XR1