TBL3 Antibody - BSA Free

Western Blot: TBL3 Antibody [NBP1-92481] - Analysis in human cell line EFO-21.

Immunocytochemistry/Immunofluorescence: TBL3 Antibody [NBP1-92481] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: TBL3 Antibody [NBP1-92481] - Staining of human testis shows high expression.

Analysis in human testis and pancreas tissues using Anti-TBL3 antibody. Corresponding TBL3 RNA-seq data are presented for the same tissues.

Analysis in human cell line EFO-21.

Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBL3 Antibody - BSA Free (NBP1-92481) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LWKDVTEAEQAEEQARQEEQVVRQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLEATMLRLRRDQKEALLRFCVTWNTNSRHCHEAQAVLGVLL
• Predicted Species: Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 89 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  TBL3 Protein (NBP1-92481PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBL3 Antibody - BSA Free

• SAZDWD repeat-containing protein SAZD
• transducin (beta)-like 3
• transducin beta-like protein 3
• WD-repeat protein SAZD

Background

The protein encoded by the TBL3 gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This gene has multiple polyadenylation sites. It might have multiple alternatively spliced transcript variants but the variants have not been fully described yet. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBL3
• Entrez:
  • 10607(Human)
• Uniprot:
  • Q12788(Human)