TBCE Antibody - BSA Free

Western Blot: TBCE Antibody [NBP1-81713] - Analysis in control (vector only transfected HEK293T lysate) and TBCE over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: TBCE Antibody [NBP1-81713] - Staining of human placenta shows cytoplasmic and membranous positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBCE Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBCE Antibody - BSA Free (NBP1-81713) is a polyclonal antibody validated for use in IHC and WB. Anti-TBCE Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERGKHDGSHEGTVYFKCRHPTGGSFIRPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIMKQQSQLSKLQEVSLRNCAVSCAGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBCE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TBCE Protein (NBP1-81713PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBCE Antibody - BSA Free

• HRDTubulin-folding cofactor E
• KCS1KCS
• Kenny-Caffey syndrome
• pac2
• tubulin folding cofactor E
• tubulin-specific chaperone e

Background

Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TBCE Antibody (NBP1-81713)(1)

Publication using NBP1-81713

• Panagiotis Efentakis, Michael Molitor, Sabine Kossmann, Magdalena L Bochenek, Johannes Wild, Jeremy Lagrange, Stefanie Finger, Rebecca Jung, Susanne Karbach, Katrin Schäfer, Andreas Schulz, Philipp Wild, Thomas Münzel, Philip Wenzel Tubulin-folding cofactor E deficiency promotes vascular dysfunction by increased endoplasmic reticulum stress European Heart Journal 2022-02-07 [PMID: 34132336]

Bioinformatics

• Gene Symbol: TBCE