TBCE Antibody

Images

 
Western Blot: TBCE Antibody [NBP1-81711] - Analysis in control (vector only transfected HEK293T lysate) and TBCE over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TBCE Antibody [NBP1-81711] - Staining of human placenta shows strong positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBCE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW
Specificity
Specificity of human TBCE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBCE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TBCE Protein (NBP1-81711PEP)
Publications
Read Publication using NBP1-81711.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBCE Antibody

  • HRDTubulin-folding cofactor E
  • KCS1KCS
  • Kenny-Caffey syndrome
  • pac2
  • tubulin folding cofactor E
  • tubulin-specific chaperone e

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47340
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-86288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15698
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00006904-B01
Species: Hu
Applications: WB
NBP2-02037
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89693
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-90295
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00000072-D01P
Species: Hu
Applications: WB
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81711
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TBCE Antibody (NBP1-81711)(1)

Reviews for TBCE Antibody (NBP1-81711) (0)

There are no reviews for TBCE Antibody (NBP1-81711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBCE Antibody (NBP1-81711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TBCE Antibody (NBP1-81711)

Discover related pathways, diseases and genes to TBCE Antibody (NBP1-81711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBCE Antibody (NBP1-81711)

Discover more about diseases related to TBCE Antibody (NBP1-81711).
 

Pathways for TBCE Antibody (NBP1-81711)

View related products by pathway.

PTMs for TBCE Antibody (NBP1-81711)

Learn more about PTMs related to TBCE Antibody (NBP1-81711).
 

Research Areas for TBCE Antibody (NBP1-81711)

Find related products by research area.

Blogs on TBCE

There are no specific blogs for TBCE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBCE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBCE