TBC1D1 Antibody

Images

 
Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-82928] - Staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TBC1D1 Protein (NBP1-82928PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D1 Antibody

  • KIAA1108TBC
  • TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1
  • TBC1 domain family member 1
  • TBC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
H00009098-M01
Species: Hu
Applications: WB, ELISA
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-37322
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-36551
Species: Hu, Mu
Applications: WB, IP
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-82928
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TBC1D1 Antibody (NBP1-82928) (0)

There are no publications for TBC1D1 Antibody (NBP1-82928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D1 Antibody (NBP1-82928) (0)

There are no reviews for TBC1D1 Antibody (NBP1-82928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TBC1D1 Antibody (NBP1-82928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBC1D1 Products

Bioinformatics Tool for TBC1D1 Antibody (NBP1-82928)

Discover related pathways, diseases and genes to TBC1D1 Antibody (NBP1-82928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D1 Antibody (NBP1-82928)

Discover more about diseases related to TBC1D1 Antibody (NBP1-82928).
 

Pathways for TBC1D1 Antibody (NBP1-82928)

View related products by pathway.

PTMs for TBC1D1 Antibody (NBP1-82928)

Learn more about PTMs related to TBC1D1 Antibody (NBP1-82928).

Blogs on TBC1D1

There are no specific blogs for TBC1D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D1