TAS1R2 Antibody - Azide and BSA Free

Western Blot: TAS1R2 Antibody [NBP3-15535] - Western blot analysis of extracts of various cell lines, using TAS1R2 Rabbit pAb (NBP3-15535) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5min.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TAS1R2 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TAS1R2 (NP_689418.2). IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAS1R2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TAS1R2 Antibody - Azide and BSA Free

• G protein-coupled receptor 71
• Sweet taste receptor T1R2
• T1R2GPR71
• taste receptor type 1 member 2
• taste receptor, type 1, member 2
• TR2G-protein coupled receptor 71

Background

Putative taste receptor. TAS1R2/TAS1R3 recognizes diverse natural and synthetic sweeteners

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TAS1R2