| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit TAS1R2 Antibody - Azide and BSA Free (NBP3-15535) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TAS1R2 (NP_689418.2). IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TAS1R2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TAS1R2 Antibody (NBP3-15535)Find related products by research area.
|
|
Taste Infographic: Explaining Taste from the Tongue to the Brain The sense of taste involves the reaction of chemicals with nerve cells which send messages to the brain to create the perception of flavor. Learn more about taste and in the infographic below.Novus Biologicals offers research reagents mentioned in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TAS1R2 |