TAP1 Recombinant Protein Antigen

Images

 
There are currently no images for TAP1 Recombinant Protein Antigen (NBP2-55934PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAP1.

Source: E. coli

Amino Acid Sequence: DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55934.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAP1 Recombinant Protein Antigen

  • ABC Transporter, MHC 1
  • ABC17
  • ABCB2
  • ABCB2FLJ41500
  • antigen peptide transporter 1
  • APT1
  • ATP-binding cassette sub-family B member 2
  • ATP-binding cassette, sub-family B (MDR/TAP), member 2
  • D6S114E
  • Ham1
  • Peptide supply factor 1
  • Peptide transporter involved in antigen processing 1
  • Peptide transporter PSF1
  • Peptide Transporter TAP1
  • PSF1
  • PSF-1
  • PSF1ABC17
  • Really interesting new gene 4 protein
  • RING4
  • RING4FLJ26666
  • TAP1
  • TAP1*0102N
  • TAP1N
  • transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
  • transporter associated with antigen processing
  • transporter, ATP-binding cassette, major histocompatibility complex, 1
  • Y3

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-86968
Species: Hu
Applications: IHC,  IHC-P
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
485-MI
Species: Mu
Applications: BA
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-55934PEP
Species: Hu
Applications: AC

Publications for TAP1 Recombinant Protein Antigen (NBP2-55934PEP) (0)

There are no publications for TAP1 Recombinant Protein Antigen (NBP2-55934PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAP1 Recombinant Protein Antigen (NBP2-55934PEP) (0)

There are no reviews for TAP1 Recombinant Protein Antigen (NBP2-55934PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TAP1 Recombinant Protein Antigen (NBP2-55934PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAP1 Products

Research Areas for TAP1 Recombinant Protein Antigen (NBP2-55934PEP)

Find related products by research area.

Blogs on TAP1

There are no specific blogs for TAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAP1