TAP1 Antibody [mFluor Violet 610 SE]

Product Discontinued

TAP1 Antibody [mFluor Violet 610 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 524-808 of human TAP1 (NP_000584.3).
  
  Sequence:
  IYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for TAP1 Antibody [mFluor Violet 610 SE]

• ABC Transporter, MHC 1
• ABC17
• ABCB2
• ABCB2FLJ41500
• antigen peptide transporter 1
• APT1
• ATP-binding cassette sub-family B member 2
• ATP-binding cassette, sub-family B (MDR/TAP), member 2
• D6S114E
• Ham1
• Peptide supply factor 1
• Peptide transporter involved in antigen processing 1
• Peptide transporter PSF1
• Peptide Transporter TAP1
• PSF1
• PSF-1
• PSF1ABC17
• Really interesting new gene 4 protein
• RING4
• RING4FLJ26666
• TAP1
• TAP1*0102N
• TAP1N
• transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• transporter associated with antigen processing
• transporter, ATP-binding cassette, major histocompatibility complex, 1
• Y3

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAP1