TAP1 Antibody [Alexa Fluor® 350]

Images

 

Product Details

Summary
Product Discontinued
View other related TAP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38230AF350
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TAP1 Antibody [Alexa Fluor® 350] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 524-808 of human TAP1 (NP_000584.3).

Sequence:
IYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for TAP1 Antibody [Alexa Fluor® 350]

  • ABC Transporter, MHC 1
  • ABC17
  • ABCB2
  • ABCB2FLJ41500
  • antigen peptide transporter 1
  • APT1
  • ATP-binding cassette sub-family B member 2
  • ATP-binding cassette, sub-family B (MDR/TAP), member 2
  • D6S114E
  • Ham1
  • Peptide supply factor 1
  • Peptide transporter involved in antigen processing 1
  • Peptide transporter PSF1
  • Peptide Transporter TAP1
  • PSF1
  • PSF-1
  • PSF1ABC17
  • Really interesting new gene 4 protein
  • RING4
  • RING4FLJ26666
  • TAP1
  • TAP1*0102N
  • TAP1N
  • transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
  • transporter associated with antigen processing
  • transporter, ATP-binding cassette, major histocompatibility complex, 1
  • Y3

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-31769
Species: Hu
Applications: IHC,  IHC-P
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-86968
Species: Hu
Applications: IHC,  IHC-P
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
485-MI
Species: Mu
Applications: BA
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP3-38230AF350
Species: Hu, Mu
Applications: WB, ELISA

Publications for TAP1 Antibody (NBP3-38230AF350) (0)

There are no publications for TAP1 Antibody (NBP3-38230AF350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAP1 Antibody (NBP3-38230AF350) (0)

There are no reviews for TAP1 Antibody (NBP3-38230AF350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAP1 Antibody (NBP3-38230AF350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAP1 Products

Research Areas for TAP1 Antibody (NBP3-38230AF350)

Find related products by research area.

Blogs on TAP1

There are no specific blogs for TAP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAP1 Antibody [Alexa Fluor® 350] and receive a gift card or discount.

Bioinformatics

Gene Symbol TAP1