TAP1 Antibody (2B4)

Images

 
Western Blot: TAP1 Antibody (2B4) [H00006890-M01] - Analysis of TAP1 expression in transfected 293T cell line by TAP1 monoclonal antibody (M01), clone 2B4. Lane 1: TAP1 transfected lysate (80.965 KDa). Lane 2: ...read more
Sandwich ELISA: TAP1 Antibody (2B4) [H00006890-M01] - Detection limit for recombinant GST tagged TAP1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAP1 Antibody (2B4) Summary

Immunogen
TAP1 (AAH14081 241 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE
Specificity
TAP1 - transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAP1 Antibody (2B4)

  • ABC transporter, MHC 1
  • ABCB2FLJ41500
  • antigen peptide transporter 1
  • APT1
  • ATP-binding cassette sub-family B member 2
  • ATP-binding cassette, sub-family B (MDR/TAP), member 2
  • D6S114E
  • Peptide supply factor 1
  • Peptide transporter involved in antigen processing 1
  • Peptide transporter PSF1
  • Peptide transporter TAP1
  • PSF-1
  • PSF1ABC17
  • Really interesting new gene 4 protein
  • RING4FLJ26666
  • TAP1*0102N
  • TAP1N
  • transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
  • transporter associated with antigen processing
  • transporter, ATP-binding cassette, major histocompatibility complex, 1
  • Y3

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00006890-M01
Species: Hu
Applications: WB, ELISA

Publications for TAP1 Antibody (H00006890-M01) (0)

There are no publications for TAP1 Antibody (H00006890-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAP1 Antibody (H00006890-M01) (0)

There are no reviews for TAP1 Antibody (H00006890-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAP1 Antibody (H00006890-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAP1 Products

Bioinformatics Tool for TAP1 Antibody (H00006890-M01)

Discover related pathways, diseases and genes to TAP1 Antibody (H00006890-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAP1 Antibody (H00006890-M01)

Discover more about diseases related to TAP1 Antibody (H00006890-M01).
 

Pathways for TAP1 Antibody (H00006890-M01)

View related products by pathway.

PTMs for TAP1 Antibody (H00006890-M01)

Learn more about PTMs related to TAP1 Antibody (H00006890-M01).
 

Research Areas for TAP1 Antibody (H00006890-M01)

Find related products by research area.

Blogs on TAP1

There are no specific blogs for TAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAP1 Antibody (2B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TAP1
Entrez
OMIM
Uniprot