TAL2 Antibody (1G6)

Images

 
Sandwich ELISA: TAL2 Antibody (1G6) [H00006887-M01] - Detection limit for recombinant GST tagged TAL2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAL2 Antibody (1G6) Summary

Immunogen
TAL2 (NP_005412, 29 a.a. - 108 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP
Specificity
TAL2 - T-cell acute lymphocytic leukemia 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAL2 Antibody (1G6)

  • bHLHa19
  • Class A basic helix-loop-helix protein 19
  • TAL-2
  • T-cell acute lymphocytic leukemia 2
  • T-cell acute lymphocytic leukemia protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27188
Species: Hu, Po, Ca, Pm
Applications: WB, Simple Western
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF6116
Species: Hu
Applications: WB, ICC
NB110-78626
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00004004-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
AF4377
Species: Hu, Mu
Applications: WB, ICC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TAL2 Antibody (H00006887-M01) (0)

There are no publications for TAL2 Antibody (H00006887-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAL2 Antibody (H00006887-M01) (0)

There are no reviews for TAL2 Antibody (H00006887-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAL2 Antibody (H00006887-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAL2 Products

Bioinformatics Tool for TAL2 Antibody (H00006887-M01)

Discover related pathways, diseases and genes to TAL2 Antibody (H00006887-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAL2 Antibody (H00006887-M01)

Discover more about diseases related to TAL2 Antibody (H00006887-M01).
 

Pathways for TAL2 Antibody (H00006887-M01)

View related products by pathway.

PTMs for TAL2 Antibody (H00006887-M01)

Learn more about PTMs related to TAL2 Antibody (H00006887-M01).

Blogs on TAL2

There are no specific blogs for TAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAL2 Antibody (1G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TAL2
Entrez
OMIM
Uniprot