TAK1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAK1L Antibody [NBP2-56145] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAK1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGS
Specificity
Specificity of human TAK1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C21ORF7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAK1L Recombinant Protein Antigen (NBP2-56145PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TAK1L Antibody

  • chromosome 21 open reading frame 7
  • HC21ORF7
  • putative gene, TGF-beta-activated kinase like10TAK1LTAK1-like protein
  • TAK1-like protein 1
  • TAK1-like protein 2
  • TAK1-like protein 4
  • TAKL
  • TAKL-1
  • TAKL-2
  • TAKL-4
  • TGF-beta activated kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67811
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46587
Species: Hu
Applications: WB, IHC
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-86818
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2576
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88937
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-90676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89395
Species: Hu
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF5510
Species: Hu
Applications: WB
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TAK1L Antibody (NBP2-56145) (0)

There are no publications for TAK1L Antibody (NBP2-56145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAK1L Antibody (NBP2-56145) (0)

There are no reviews for TAK1L Antibody (NBP2-56145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAK1L Antibody (NBP2-56145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAK1L Products

Bioinformatics Tool for TAK1L Antibody (NBP2-56145)

Discover related pathways, diseases and genes to TAK1L Antibody (NBP2-56145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAK1L Antibody (NBP2-56145)

Discover more about diseases related to TAK1L Antibody (NBP2-56145).
 

Pathways for TAK1L Antibody (NBP2-56145)

View related products by pathway.

Blogs on TAK1L

There are no specific blogs for TAK1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAK1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C21ORF7