TAK1L Antibody

Images

 
Immunohistochemistry: TAK1L Antibody [NBP1-81767] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAK1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQI
Specificity
Specificity of human TAK1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C21ORF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAK1L Protein (NBP1-81767PEP)
Publications
Read Publication using NBP1-81767.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAK1L Antibody

  • chromosome 21 open reading frame 7
  • HC21ORF7
  • putative gene, TGF-beta-activated kinase like10TAK1LTAK1-like protein
  • TAK1-like protein 1
  • TAK1-like protein 2
  • TAK1-like protein 4
  • TAKL
  • TAKL-1
  • TAKL-2
  • TAKL-4
  • TGF-beta activated kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46587
Species: Hu
Applications: WB, IHC
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-86818
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2576
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88937
Species: Hu
Applications: IHC, IHC-P
930-ADB
Species: Hu
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF5510
Species: Hu
Applications: WB
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81767
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TAK1L Antibody (NBP1-81767)(1)

Reviews for TAK1L Antibody (NBP1-81767) (0)

There are no reviews for TAK1L Antibody (NBP1-81767). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAK1L Antibody (NBP1-81767) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TAK1L Antibody (NBP1-81767)

Discover related pathways, diseases and genes to TAK1L Antibody (NBP1-81767). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAK1L Antibody (NBP1-81767)

Discover more about diseases related to TAK1L Antibody (NBP1-81767).
 

Pathways for TAK1L Antibody (NBP1-81767)

View related products by pathway.

Blogs on TAK1L

There are no specific blogs for TAK1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAK1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C21ORF7