Recombinant Human TAF5L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TAF5L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-117 of Human TAF5L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TAF5L

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAF5L Protein

  • PAF65B
  • PAF65BPAF65-beta
  • PCAF associated factor 65 beta
  • PCAF-associated factor 65 beta
  • TAF5L
  • TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 5L
  • TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD
  • TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa

Background

TAF5L - TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76307
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80356
Species: Hu
Applications: WB, IHC, IHC-P
AF5596
Species: Hu
Applications: WB, IHC, ICC
NBP2-31968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49218
Species: Hu
Applications: IHC
H00005956-R02
Species: Hu
NB100-1720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-55408
Species: Hu
Applications: WB, ICC/IF
H00027097-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TAF5L Partial Recombinant Protein (H00027097-Q01) (0)

There are no publications for TAF5L Partial Recombinant Protein (H00027097-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF5L Partial Recombinant Protein (H00027097-Q01) (0)

There are no reviews for TAF5L Partial Recombinant Protein (H00027097-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF5L Partial Recombinant Protein (H00027097-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF5L Products

Bioinformatics Tool for TAF5L Partial Recombinant Protein (H00027097-Q01)

Discover related pathways, diseases and genes to TAF5L Partial Recombinant Protein (H00027097-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF5L Partial Recombinant Protein (H00027097-Q01)

Discover more about diseases related to TAF5L Partial Recombinant Protein (H00027097-Q01).
 

Pathways for TAF5L Partial Recombinant Protein (H00027097-Q01)

View related products by pathway.

Blogs on TAF5L

There are no specific blogs for TAF5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAF5L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF5L
Entrez