Recombinant Human TAF5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TAF5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 428-535 of Human TAF5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TAF5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAF5 Protein

  • TAF(II)100
  • TAF2DTATA box binding protein (TBP)-associated factor 2D
  • TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAFII100TAFII-100
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD
  • transcription initiation factor TFIID 100 kD subunit
  • Transcription initiation factor TFIID 100 kDa subunit
  • transcription initiation factor TFIID subunit 5

Background

TAF5 - TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP1-82774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-80703
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-21371
Species: Hu, Mu
Applications: ChIP, IP
NBP1-80706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TAF5 Partial Recombinant Protein (H00006877-Q01) (0)

There are no publications for TAF5 Partial Recombinant Protein (H00006877-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF5 Partial Recombinant Protein (H00006877-Q01) (0)

There are no reviews for TAF5 Partial Recombinant Protein (H00006877-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF5 Partial Recombinant Protein (H00006877-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF5 Products

Bioinformatics Tool for TAF5 Partial Recombinant Protein (H00006877-Q01)

Discover related pathways, diseases and genes to TAF5 Partial Recombinant Protein (H00006877-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF5 Partial Recombinant Protein (H00006877-Q01)

Discover more about diseases related to TAF5 Partial Recombinant Protein (H00006877-Q01).
 

Pathways for TAF5 Partial Recombinant Protein (H00006877-Q01)

View related products by pathway.

PTMs for TAF5 Partial Recombinant Protein (H00006877-Q01)

Learn more about PTMs related to TAF5 Partial Recombinant Protein (H00006877-Q01).

Blogs on TAF5

There are no specific blogs for TAF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TAF5 Antibody
NBP1-86971

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAF5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF5