TAF1B Antibody - BSA Free

Western Blot: TAF1B Antibody [NBP2-82353] - WB Suggested Anti-TAF1B Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: SP2/0 cell lysate

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

TAF1B Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B. Peptide sequence: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF1B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for TAF1B Antibody - BSA Free

• RAF1BTATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kD
• RAFI63MGC:9349
• RNA polymerase I-specific TBP-associated factor 63 kDa
• SL1SL1, 63kD subunit
• TAFI63TBP-associated factor 1B
• TATA box binding protein (TBP)-associated factor, RNA polymerase I, B, 63kDa
• TATA box-binding protein-associated factor 1B
• TATA box-binding protein-associated factor RNA polymerase I subunit B
• Transcription initiation factor SL1/TIF-IB subunit B

Background

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes one of the SL1-specific TAFs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF1B