TAF13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAF13 Antibody [NBP1-92474] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TAF13 Antibody [NBP1-92474] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRA
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF13 Protein (NBP1-92474PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF13 Antibody

  • 18kDa
  • MGC22425
  • TAF(II)18
  • TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2K
  • TAFII18TAFII-18
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD
  • transcription initiation factor TFIID 18 kD subunit
  • Transcription initiation factor TFIID 18 kDa subunit
  • transcription initiation factor TFIID subunit 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00006882-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-45466
Species: Hu, Mu, Rt
Applications: IHC, PAGE, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1334
Species: Hu
Applications: IHC, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-01967
Species: Hu, Mu, Rt
Applications: WB
NBP3-13814
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
NBP2-92972
Species: Hu, Mu, Rt
Applications: IP, KO, WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-511
Species: Hu, Mu
Applications: IP, WB
NBP1-92685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00023327-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-32622
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-55408
Species: Hu
Applications: ICC/IF, WB

Publications for TAF13 Antibody (NBP1-92474) (0)

There are no publications for TAF13 Antibody (NBP1-92474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF13 Antibody (NBP1-92474) (0)

There are no reviews for TAF13 Antibody (NBP1-92474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAF13 Antibody (NBP1-92474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF13 Products

Bioinformatics Tool for TAF13 Antibody (NBP1-92474)

Discover related pathways, diseases and genes to TAF13 Antibody (NBP1-92474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF13 Antibody (NBP1-92474)

Discover more about diseases related to TAF13 Antibody (NBP1-92474).
 

Pathways for TAF13 Antibody (NBP1-92474)

View related products by pathway.

Blogs on TAF13

There are no specific blogs for TAF13, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF13