TAF11 Antibody (3H5)


Western Blot: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of TAF11 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: TAF11 Antibody (3H5) [H00006882-M03] - Analysis of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human smooth muscle. Antibody concentration 1.2 ug/ml
Sandwich ELISA: TAF11 Antibody (3H5) [H00006882-M03] - Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P

Order Details

TAF11 Antibody (3H5) Summary

TAF11 (NP_005634 158 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
TAF11 (3H5)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Positive Control
TAF11 Lysate (NBP2-65213)

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF11 Antibody (3H5)

  • 28kDa
  • TAF(II)28
  • TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2IMGC:15243
  • TAFII-28
  • TAFII28TFIID subunit p30-beta
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD
  • transcription initiation factor TFIID 28 kD subunit
  • Transcription initiation factor TFIID 28 kDa subunit
  • transcription initiation factor TFIID subunit 11


Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB (-), IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA, CHIP-SEQ
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu

Publications for TAF11 Antibody (H00006882-M03) (0)

There are no publications for TAF11 Antibody (H00006882-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF11 Antibody (H00006882-M03) (0)

There are no reviews for TAF11 Antibody (H00006882-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF11 Antibody (H00006882-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TAF11 Products

Bioinformatics Tool for TAF11 Antibody (H00006882-M03)

Discover related pathways, diseases and genes to TAF11 Antibody (H00006882-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF11 Antibody (H00006882-M03)

Discover more about diseases related to TAF11 Antibody (H00006882-M03).

Pathways for TAF11 Antibody (H00006882-M03)

View related products by pathway.

Blogs on TAF11

There are no specific blogs for TAF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TAF11 Antibody (3H5) and receive a gift card or discount.


Gene Symbol TAF11