TADA3L Antibody - Azide and BSA Free

Western Blot: TADA3L Antibody [H00010474-D01P] - Analysis of TADA3L expression in transfected 293T cell line by TADA3L polyclonal antibody.Lane 1: TADA3L transfected lysate(41.40 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TADA3L Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TADA3L Antibody - Azide and BSA Free (H00010474-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TADA3L (NP_597814.1, 1 a.a. - 369 a.a.) full-length human protein. MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR
• Specificity: Reacts with transcriptional adaptor 3 (NGG1 homolog, yeast)-like.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TADA3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TADA3L Antibody - Azide and BSA Free

• ADA3 homolog
• ADA3
• alteration/deficiency in activation 3
• epididymis secretory sperm binding protein
• FLJ20221
• FLJ21329
• hADA3
• NGG1
• STAF54
• TADA3L
• transcriptional adapter 3
• Transcriptional adapter 3-like
• transcriptional adaptor 3

Background

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least four alternatively spliced variants have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TADA3
• Entrez:
  • 10474(Human)
• Uniprot:
  • NP_597814.1(Human)