TADA1L Antibody

Images

 
Western Blot: TADA1L Antibody [NBP1-56629] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TADA1L Antibody Summary

Immunogen
Synthetic peptides corresponding to TADA1L(transcriptional adaptor 1 (HFI1 homolog, yeast)-like) The peptide sequence was selected from the C terminal of TADA1L (NP_444281). Peptide sequence REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TADA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TADA1L and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TADA1L Antibody

  • ADA1
  • hADA1
  • HFI1
  • SPT3-associated factor 42 (STAF42)
  • SPT3-associated factor 42
  • STAF42transcriptional adaptor 1 (HFI1 homolog, yeast)-like
  • TADA1LRP1-9E21.4
  • transcriptional adapter 1
  • Transcriptional adapter 1-like protein
  • transcriptional adaptor 1 (HFI1 homolog, yeast)
  • transcriptional adaptor 1

Background

TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP2-86955
Species: Hu
Applications: WB
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP2-45466
Species: Hu
Applications: WB, IHC, PAGE
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
AF7365
Species: Hu, Mu, Rt
Applications: WB
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
MAB2695
Species: Hu
Applications: WB
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF5075
Species: Hu, Mu, Rt
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-56629
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for TADA1L Antibody (NBP1-56629) (0)

There are no publications for TADA1L Antibody (NBP1-56629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TADA1L Antibody (NBP1-56629) (0)

There are no reviews for TADA1L Antibody (NBP1-56629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TADA1L Antibody (NBP1-56629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TADA1L Products

Array NBP1-56629

Bioinformatics Tool for TADA1L Antibody (NBP1-56629)

Discover related pathways, diseases and genes to TADA1L Antibody (NBP1-56629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TADA1L

There are no specific blogs for TADA1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TADA1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA1
Entrez
Uniprot