TACC3 Antibody (6C4) - Azide and BSA Free Summary
Immunogen |
TACC3 (NP_006333, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK |
Specificity |
TACC3 (6C4) |
Isotype |
IgG3 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TACC3 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for immunohistochemistry (paraffin) and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TACC3 Antibody (6C4) - Azide and BSA Free
Background
The function of this gene has not yet been determined; however, it is speculated that it may be involved in cell growth and differentiation. Expression of this gene is up-regulated in some cancer cell lines, and in embryonic day 15 in mice.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Ma, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu
Applications: Flow, ICC, IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: WB, ELISA, IHC
Publications for TACC3 Antibody (H00010460-M02) (0)
There are no publications for TACC3 Antibody (H00010460-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TACC3 Antibody (H00010460-M02) (0)
There are no reviews for TACC3 Antibody (H00010460-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TACC3 Antibody (H00010460-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TACC3 Products
Research Areas for TACC3 Antibody (H00010460-M02)
Find related products by research area.
|
Blogs on TACC3