TACC1 Antibody - BSA Free

Western Blot: TACC1 Antibody [NBP2-88400] - Host: Rabbit. Target Name: TACC1. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

TACC1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TACC1. Peptide sequence: PKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TACC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TACC1 Antibody - BSA Free

• DKFZp686K18126
• FLJ42304
• Ga55
• Gastric cancer antigen Ga55
• KIAA1103
• taxin 1
• taxin-1
• transforming acidic coiled-coil-containing protein 1
• transforming, acidic coiled-coil containing protein 1

Background

TACC1 is thought to be involved in the processes that promote cell division prior to the formation of differentiated tissues. It interacts with KIAA0097/CH-TOG and with the oncogenic transcription factor YEATS4, in addition to the Aurora kinases A and B (STK6 and AURKB) and LSM7, TDRD7 and SNRPG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TACC1