SYT7 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 38-170 of human SYT7 (NP_004191.2). CHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SYT7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SYT7 Antibody - Azide and BSA Free
Background
Synaptotagmins, such as SYT7, are brain-specific calcium-dependent phospholipid-binding proteins that play a role in synaptic exocytosis and neurotransmitter release. See MIM 600782.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SYT7 Antibody (NBP2-93228) (0)
There are no publications for SYT7 Antibody (NBP2-93228).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SYT7 Antibody (NBP2-93228) (0)
There are no reviews for SYT7 Antibody (NBP2-93228).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SYT7 Antibody (NBP2-93228) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SYT7 Products
Research Areas for SYT7 Antibody (NBP2-93228)
Find related products by research area.
|
Blogs on SYT7