![Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/SYS1-Antibody-Immunohistochemistry-Paraffin-NBP2-13407-img0006.jpg "Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-NBP2-46542-img0001.jpg)
-Immunohistochemistry-NBP2-46542-img0002.jpg)
-Immunohistochemistry-NBP2-46542-img0003.jpg)
-Sandwich-ELISA-H00079087-M06-img0004.jpg)
-Western-Blot-H00079087-M06-img0006.jpg)
-Western-Blot-H00079087-M06-img0005.jpg)
-Flow-Cytometry-NB600-1071-img0015.jpg)
-Flow-Cytometry-NB600-1071-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NB600-1071-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for SYS1 Antibody (NBP2-13407)Discover more about diseases related to SYS1 Antibody (NBP2-13407).
| Pathways for SYS1 Antibody (NBP2-13407)View related products by pathway.
|
PTMs for SYS1 Antibody (NBP2-13407)Learn more about PTMs related to SYS1 Antibody (NBP2-13407).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYS1 |
![Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human ovary shows nuclear positivity.](http://images.novusbio.com/fullsize2/SYS1-Antibody-Immunohistochemistry-Paraffin-NBP2-13407-img0003.jpg "Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human ovary shows nuclear positivity.")
![Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human cerebellum shows weak granular cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize2/SYS1-Antibody-Immunohistochemistry-Paraffin-NBP2-13407-img0004.jpg "Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human cerebellum shows weak granular cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry: SYS1 Antibody [NBP2-13407] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/SYS1-Antibody-Immunohistochemistry-NBP2-13407-img0005.jpg "Immunohistochemistry: SYS1 Antibody [NBP2-13407] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
-ELISA-H00057016-M01-img0004.jpg)
-Immunocytochemistry-Immunofluorescence-H00057016-M01-img0007.jpg)
-Immunohistochemistry-Paraffin-H00057016-M01-img0009.jpg)
![Bioactivity Thrombopoietin/THPO [Unconjugated]](https://images.novusbio.com/images/protein/288-tpncf_recombinant-human-thrombopoietin-ns0-expressed-protein-cf-bioactivity-272020135047.jpg)
![SDS-PAGE IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_345.jpg)
![Bioactivity IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_347.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_555.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_556.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_20.jpg)
![SCF/c-kit Ligand [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "SCF/c-kit Ligand [Unconjugated]")
-Immunohistochemistry-Paraffin-NBP2-34294-img0003.jpg)
-Immunohistochemistry-NBP2-34294-img0004.jpg)
-Immunohistochemistry-Paraffin-NBP2-34294-img0005.jpg)
-Western-Blot-H00007873-M01-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-H00007873-M01-img0006.jpg)
-Sandwich-ELISA-H00007873-M01-img0005.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")