SYS1 Antibody

Images

 
Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human ovary shows nuclear positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SYS1 Protein (NBP2-13407PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYS1 Antibody

  • C20orf169
  • chromosome 20 open reading frame 169
  • dJ453C12.4
  • dJ453C12.4.1
  • protein SYS1 homolog
  • SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46542
Species: Hu
Applications: WB, IHC
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49680
Species: Hu
Applications: WB, IHC
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55172
Species: Hu
Applications: WB
NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079087-M06
Species: Hu, Rt
Applications: WB, ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34951
Species: Hu
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-76511
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SYS1 Antibody (NBP2-13407) (0)

There are no publications for SYS1 Antibody (NBP2-13407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYS1 Antibody (NBP2-13407) (0)

There are no reviews for SYS1 Antibody (NBP2-13407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SYS1 Antibody (NBP2-13407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYS1 Products

Bioinformatics Tool for SYS1 Antibody (NBP2-13407)

Discover related pathways, diseases and genes to SYS1 Antibody (NBP2-13407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYS1 Antibody (NBP2-13407)

Discover more about diseases related to SYS1 Antibody (NBP2-13407).
 

Pathways for SYS1 Antibody (NBP2-13407)

View related products by pathway.

PTMs for SYS1 Antibody (NBP2-13407)

Learn more about PTMs related to SYS1 Antibody (NBP2-13407).

Blogs on SYS1

There are no specific blogs for SYS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYS1