SYS1 Antibody


Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human ovary shows nuclear positivity.
Immunohistochemistry-Paraffin: SYS1 Antibody [NBP2-13407] - Staining of human cerebellum shows weak granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: SYS1 Antibody [NBP2-13407] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

SYS1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM
Specificity of human SYS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SYS1 Protein (NBP2-13407PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SYS1 Antibody

  • C20orf169
  • chromosome 20 open reading frame 169
  • dJ453C12.4
  • dJ453C12.4.1
  • protein SYS1 homolog
  • SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, Fi, I, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF

Publications for SYS1 Antibody (NBP2-13407) (0)

There are no publications for SYS1 Antibody (NBP2-13407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYS1 Antibody (NBP2-13407) (0)

There are no reviews for SYS1 Antibody (NBP2-13407). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SYS1 Antibody (NBP2-13407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SYS1 Products

Bioinformatics Tool for SYS1 Antibody (NBP2-13407)

Discover related pathways, diseases and genes to SYS1 Antibody (NBP2-13407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYS1 Antibody (NBP2-13407)

Discover more about diseases related to SYS1 Antibody (NBP2-13407).

Pathways for SYS1 Antibody (NBP2-13407)

View related products by pathway.

PTMs for SYS1 Antibody (NBP2-13407)

Learn more about PTMs related to SYS1 Antibody (NBP2-13407).

Blogs on SYS1

There are no specific blogs for SYS1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SYS1 Antibody and receive a gift card or discount.


Gene Symbol SYS1