SYPL1 Antibody - BSA Free

Western Blot: SYPL1 Antibody [NBP2-88397] - WB Suggested Anti-SYPL1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Thymus

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SYPL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SYPL1 Antibody - BSA Free (NBP2-88397) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of SYPL1. Peptide sequence: MGSLNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSAPHSQGGIPPPT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYPL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SYPL1 Antibody - BSA Free

• H-SP1
• pantophysin
• synaptophysin-like 1
• synaptophysin-like protein 1
• synaptophysin-like protein
• SYPL

Background

SYPL1 is a gene that codes for a protein that has two isoforms, with lengths of 259 and 241 amino acids and weights of approximately 29 and 26 kDa respectively. Current research is being done on diseases and disorders related to this gene including neruonitis and alcoholism. SYPL1 has also been shown to have interactions with VAMP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYPL1