Syntrophin alpha 1 Antibody - Azide and BSA Free

Western Blot: Syntrophin alpha 1 Antibody [NBP3-16017] - Western blot analysis of extracts of various cell lines, using Syntrophin alpha 1 antibody (NBP3-16017) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Syntrophin alpha 1 Antibody [NBP3-16017] - Western blot analysis of extracts of various cell lines, using Syntrophin alpha 1 antibody (NBP3-16017) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunocytochemistry/Immunofluorescence: Syntrophin alpha 1 Antibody [NBP3-16017] - Immunofluorescence analysis of NIH/3T3 cells using Syntrophin alpha 1 Rabbit pAb (NBP3-16017) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Syntrophin alpha 1 Antibody - Azide and BSA Free [Syntrophin alpha 1] - Immunofluorescence analysis of PC-12 cells using Syntrophin alpha 1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Syntrophin alpha 1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Syntrophin alpha 1 Antibody - Azide and BSA Free (NBP3-16017) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human Syntrophin alpha 1 (NP_003089.1). MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNTA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Syntrophin alpha 1 Antibody - Azide and BSA Free

• 59 kDa dystrophin-associated protein A1 acidic component 1
• dJ1187J4.5
• LQT12
• Pro-TGF-alpha cytoplasmic domain-interacting protein 1
• SNT1alpha-1-syntrophin
• syntrophin, alpha 1 (dystrophin-associated protein A1, 59kD, acidic component)
• syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component)
• syntrophin-1
• TACIP1acidic alpha 1 syntrophin

Background

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNTA1