Syntenin 1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Syntenin 1 Antibody [NBP1-86979] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, nuclear membrane & cytosol.

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-86979] - Staining of human placenta shows weak tcytoplasmic positivity in trophoblastic cells.

Analysis in human cell line SK-MEL-30 and human cell line MCF-7.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Syntenin 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SDCBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 24305713). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Syntenin 1 Protein (NBP1-86979PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%). Human reactivity reported in scientific literature (PMID: 24305713).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntenin 1 Antibody - BSA Free

• MDA9
• MDA-9
• melanoma differentiation associated protein-9
• Melanoma differentiation-associated protein 9
• Pro-TGF-alpha cytoplasmic domain-interacting protein 18
• Scaffold protein Pbp1
• ST1
• SYCLTACIP18
• syndecan binding protein (syntenin)
• Syndecan-binding protein 1
• syntenin-1

Background

Syntenin 1 is encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Syntenin 1 Antibody (NBP1-86979)(1)

Publication using NBP1-86979

• Kegelman TP, Das SK, Hu B et al. MDA-9/syntenin is a key regulator of glioma pathogenesis. Neuro Oncol 2014-01-01 [PMID: 24305713] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SDCBP