Syntenin 1 Antibody - Azide and BSA Free

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - Analysis of SDCBP expression in human pancreas.

Immunocytochemistry/Immunofluorescence: Syntenin 1 Antibody [H00006386-B01P] - Analysis of purified antibody to SDCBP on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - analysis of SDCBP expression in transfected 293T cell line by SDCBP purified MaxPab polyclonal antibody (B01P). Lane 1: SDCBP transfected lysate (32.40 KDa). Lane 2: Non-transfected lysate.

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - SDCBP MaxPab polyclonal antibody. Western Blot analysis of SDCBP expression in human kidney.

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - Analysis of SDCBP expression in A-549.

Western Blot: Syntenin 1 Antibody [H00006386-B01P] - Analysis of SDCBP expression in transfected 293T cell line by SDCBP polyclonal antibody. Lane 1: SDCBP transfected lysate(32.78 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Syntenin 1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SDCBP (NP_001007068.1, 1 a.a. - 298 a.a.) full-length human protein. MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
• Specificity: SDCBP - syndecan binding protein (syntenin),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SDCBP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntenin 1 Antibody - Azide and BSA Free

• MDA9
• MDA-9
• melanoma differentiation associated protein-9
• Melanoma differentiation-associated protein 9
• Pro-TGF-alpha cytoplasmic domain-interacting protein 18
• Scaffold protein Pbp1
• ST1
• SYCLTACIP18
• syndecan binding protein (syntenin)
• Syndecan-binding protein 1
• syntenin-1

Background

The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Syntenin 1 Antibody (H00006386-B01P)(2)

Publications using H00006386-B01P

• Anfaiha-Sanchez M, Santiago-Hernandez A, Lopez JA et al. Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease Journal of Extracellular Biology 2024-09-17 [PMID: 39290459]
• Raimondo F, Morosi L, Corbetta S et al. Differential protein profiling of renal cell carcinoma urinary exosomes. Mol Biosyst. 2013-03-19 [PMID: 23511837]

Bioinformatics

• Gene Symbol: SDCBP
• Entrez:
  • 6386(Human)
• Uniprot:
  • NP_001007068.1(Human)