Syntenin 1 Antibody (3J5O6)

Western Blot: Syntenin 1 Antibody (3J5O6) [NBP3-16603] - Analysis of extracts of various cell lines, using Syntenin 1 Rabbit mAb (NBP3-16603) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunohistochemistry-Paraffin: Syntenin 1 Antibody (3J5O6) [NBP3-16603] - Mouse brain using Syntenin 1 Rabbit mAb (NBP3-16603) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Syntenin 1 Antibody (3J5O6) [NBP3-16603] - Rat brain using Syntenin 1 Rabbit mAb (NBP3-16603) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Syntenin 1 Antibody (3J5O6) [NBP3-16603] - Human colon using Syntenin 1 Rabbit mAb (NBP3-16603) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry: Syntenin 1 Antibody (3J5O6) [Syntenin 1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Syntenin 1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3J5O6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Syntenin 1 Antibody (3J5O6) Summary

• Description: Novus Biologicals Rabbit Syntenin 1 Antibody (3J5O6) (NBP3-16603) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntenin 1 (O00560). MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SDCBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntenin 1 Antibody (3J5O6)

• MDA9
• MDA-9
• melanoma differentiation associated protein-9
• Melanoma differentiation-associated protein 9
• Pro-TGF-alpha cytoplasmic domain-interacting protein 18
• Scaffold protein Pbp1
• ST1
• SYCLTACIP18
• syndecan binding protein (syntenin)
• Syndecan-binding protein 1
• syntenin-1

Background

Syntenin 1 is encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SDCBP