Syntaxin-BP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Syntaxin-BP2 Antibody [NBP1-83137] - Immunofluorescent staining of human cell line RT4 shows localization to cytosol.
Immunohistochemistry-Paraffin: Syntaxin-BP2 Antibody [NBP1-83137] - Staining of human gall bladder shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaxin-BP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STXBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Syntaxin-BP2 Protein (NBP1-83137PEP)
Publications
Read Publication using NBP1-83137.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntaxin-BP2 Antibody

  • FHL5
  • Hunc18b
  • MUNC18-2
  • Protein unc-18 homolog 2
  • Protein unc-18 homolog B
  • STXBP2
  • syntaxin binding protein 2
  • syntaxin-binding protein 2
  • SyntaxinBP2
  • Syntaxin-BP2
  • Unc18-2
  • UNC18B
  • unc-18B
  • UNC18Bpp10122

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86122
Species: Hu
Applications: WB, IHC, IHC-P
NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5659
Species: Hu
Applications: WB
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00000072-D01P
Species: Hu
Applications: WB
NBP1-89278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26395
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-84978
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-15131
Species: Hu
Applications: WB

Publications for Syntaxin-BP2 Antibody (NBP1-83137)(1)

Reviews for Syntaxin-BP2 Antibody (NBP1-83137) (0)

There are no reviews for Syntaxin-BP2 Antibody (NBP1-83137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Syntaxin-BP2 Antibody (NBP1-83137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin-BP2 Products

Bioinformatics Tool for Syntaxin-BP2 Antibody (NBP1-83137)

Discover related pathways, diseases and genes to Syntaxin-BP2 Antibody (NBP1-83137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin-BP2 Antibody (NBP1-83137)

Discover more about diseases related to Syntaxin-BP2 Antibody (NBP1-83137).
 

Pathways for Syntaxin-BP2 Antibody (NBP1-83137)

View related products by pathway.

PTMs for Syntaxin-BP2 Antibody (NBP1-83137)

Learn more about PTMs related to Syntaxin-BP2 Antibody (NBP1-83137).

Blogs on Syntaxin-BP2

There are no specific blogs for Syntaxin-BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin-BP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STXBP2
Entrez