We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Syntaxin-BP1 Recombinant Protein Antigen

Images

 
There are currently no images for Syntaxin-BP1 Protein (NBP1-83138PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Syntaxin-BP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STXBP1.

Source: E. coli

Amino Acid Sequence: NGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STXBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83138.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Syntaxin-BP1 Recombinant Protein Antigen

  • EIEE4
  • FLJ37475
  • hUNC18
  • MUNC18-1
  • NSEC1
  • N-Sec1
  • p67
  • Protein unc-18 homolog 1
  • Protein unc-18 homolog A
  • rbSec1
  • STXBP1
  • syntaxin binding protein 1
  • syntaxin-binding protein 1
  • SyntaxinBP1
  • Syntaxin-BP1
  • UNC18
  • unc18-1
  • UNC18A
  • Unc-18A
  • UNC18neuronal SEC1

Background

Munc-18 (mammalian homologue of Unc-18) is a protein that is thought to be involved in regulating exocytosis due, at least in part to its ability to bind syntaxin (Ciufo et al., 2005). Munc18-1 is a neuron-specific member of the Sec1/Munc18 protein family that binds to syntaxin1A and is thought to stabilize the complex (Liu et al., 2004). The function of Munc-18 is thought to be regulated by PKC phosphorylation of Ser515 on the Munc-18 protein (Sassa et al., 1996).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-41012
Species: Hu
Applications: ELISA, Flow-IC, Flow, IHC, IHC-Fr,  IHC-P, WB
NB100-790
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, PEP-ELISA, WB
NBP2-74245
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84254
Species: Hu
Applications: IHC,  IHC-P
NBP1-52105
Species: Hu, Rt
Applications: Flow, IHC,  IHC-P, PEP-ELISA, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Syntaxin-BP1 Protein (NBP1-83138PEP) (0)

There are no publications for Syntaxin-BP1 Protein (NBP1-83138PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin-BP1 Protein (NBP1-83138PEP) (0)

There are no reviews for Syntaxin-BP1 Protein (NBP1-83138PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Syntaxin-BP1 Protein (NBP1-83138PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Syntaxin-BP1 Products

Research Areas for Syntaxin-BP1 Protein (NBP1-83138PEP)

Find related products by research area.

Blogs on Syntaxin-BP1

There are no specific blogs for Syntaxin-BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Syntaxin-BP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STXBP1