Syntaxin 4 Antibody (6A1)

Images

 
Western Blot: Syntaxin 4 Antibody (6A1) [H00006810-M02] - STX4A monoclonal antibody (M02), clone 6A1. Analysis of STX4A expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: Syntaxin 4 Antibody (6A1) [H00006810-M02] - Analysis of monoclonal antibody to STX4 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Syntaxin 4 Antibody (6A1) [H00006810-M02] - STX4A monoclonal antibody (M02), clone 6A1. Analysis of STX4A expression in HeLa.
Western Blot: Syntaxin 4 Antibody (6A1) [H00006810-M02] - STX4A monoclonal antibody (M02), clone 6A1. Analysis of STX4A expression in NIH/3T3.
Sandwich ELISA: Syntaxin 4 Antibody (6A1) [H00006810-M02] - Detection limit for recombinant GST tagged STX4A is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Syntaxin 4 Antibody (6A1) Summary

Immunogen
STX4A (NP_004595, 19 a.a. - 119 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Specificity
STX4A - syntaxin 4A (placental) (6A1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STX4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntaxin 4 Antibody (6A1)

  • NY-REN-31
  • p35-2
  • Renal carcinoma antigen NY-REN-31
  • STX4
  • STX4Ap35-2
  • Syntaxin 4
  • syntaxin 4A (placental)
  • syntaxin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
AF5659
Species: Hu
Applications: WB
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
AF5354
Species: Hu
Applications: WB, IHC
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB2568
Species: Mu
Applications: WB, IHC
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4828
Species: Hu, Mu
Applications: WB, IHC
AF6386
Species: Hu
Applications: WB, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for Syntaxin 4 Antibody (H00006810-M02) (0)

There are no publications for Syntaxin 4 Antibody (H00006810-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 4 Antibody (H00006810-M02) (0)

There are no reviews for Syntaxin 4 Antibody (H00006810-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntaxin 4 Antibody (H00006810-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 4 Products

Bioinformatics Tool for Syntaxin 4 Antibody (H00006810-M02)

Discover related pathways, diseases and genes to Syntaxin 4 Antibody (H00006810-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 4 Antibody (H00006810-M02)

Discover more about diseases related to Syntaxin 4 Antibody (H00006810-M02).
 

Pathways for Syntaxin 4 Antibody (H00006810-M02)

View related products by pathway.

Blogs on Syntaxin 4

There are no specific blogs for Syntaxin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 4 Antibody (6A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol STX4
Entrez
Uniprot