Syntaxin 3 Antibody (3L9Y9)

Western Blot: Syntaxin 3 Antibody (3L9Y9) [NBP3-16260] - Western blot analysis of extracts of various cell lines, using Syntaxin 3 Rabbit mAb (NBP3-16260) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunohistochemistry-Paraffin: Syntaxin 3 Antibody (3L9Y9) [NBP3-16260] - Immunohistochemistry of paraffin-embedded mouse kidney using Syntaxin 3 Rabbit mAb (NBP3-16260) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Syntaxin 3 Antibody (3L9Y9) [NBP3-16260] - Immunohistochemistry of paraffin-embedded rat kidney using Syntaxin 3 Rabbit mAb (NBP3-16260) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 3L9Y9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Syntaxin 3 Antibody (3L9Y9) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Syntaxin 3 (Q13277). KHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKD
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: STX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntaxin 3 Antibody (3L9Y9)

• FLJ30906
• STX3Asyntaxin 3A
• syntaxin 3
• syntaxin-3

Background

Syntaxin 3 is a member of the SNARE family of proteins and is related to syntaxin 1. While often co-expressed with syntaxins 2 and 4 within the same cell type, its membrane localization is usually different, for instance in epithelial cells or in the exocrine pancreas. Like syntaxins 1,2, and 4 it appears to be involved in the fusion of transport vesicles with the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STX3