![Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human testis shows moderate cytoplasmic positivity in peritubular myoid cells.](http://images.novusbio.com/fullsize/SYNPO2-Antibody-Immunohistochemistry-Paraffin-NBP2-48595-img0008.jpg "Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human testis shows moderate cytoplasmic positivity in peritubular myoid cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SYNPO2 Antibody - BSA Free (NBP2-48595) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGASETANIQRMVPMNRTAKPFPGSVNQPAT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SYNPO2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SYNPO2 Antibody (NBP2-48595)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SYNPO2 |
![Immunohistochemistry: SYNPO2 Antibody [NBP2-48595] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/SYNPO2-Antibody-Immunohistochemistry-NBP2-48595-img0001.jpg "Immunohistochemistry: SYNPO2 Antibody [NBP2-48595] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human smooth muscle shows high expression.](http://images.novusbio.com/fullsize/SYNPO2-Antibody-Immunohistochemistry-Paraffin-NBP2-48595-img0003.jpg "Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human smooth muscle shows high expression.")
![Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Analysis in human skeletal muscle and skin tissues using NBP2-48595 antibody. Corresponding SYNPO2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SYNPO2-Antibody-Immunohistochemistry-Paraffin-NBP2-48595-img0005.jpg "Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Analysis in human skeletal muscle and skin tissues using NBP2-48595 antibody. Corresponding SYNPO2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/SYNPO2-Antibody-Immunohistochemistry-Paraffin-NBP2-48595-img0006.jpg "Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/SYNPO2-Antibody-Immunohistochemistry-Paraffin-NBP2-48595-img0007.jpg "Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human skin shows weak cytoplasmic positivity in a subset of squamous epithelial cells.](http://images.novusbio.com/fullsize/SYNPO2-Antibody-Immunohistochemistry-Paraffin-NBP2-48595-img0009.jpg "Immunohistochemistry-Paraffin: SYNPO2 Antibody [NBP2-48595] - Staining of human skin shows weak cytoplasmic positivity in a subset of squamous epithelial cells.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")