Recombinant Human Syncollin GST (N-Term) Protein Summary
Description |
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 134 of Human SYCN full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYENCCGGAELSLESGADLPYLPSNWANTASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCS |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Full Length Recombinant Protein |
Gene |
SYCN |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
40.8 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Syncollin GST (N-Term) Protein
Background
Syncollin functions in exocytosis in pancreatic acinar cells regulating the fusion of zymogen granules with each other.May have a pore-forming activity on membranes and regulate exocytosis in other exocrine tissues
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, Simple Western, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PCR, WB
Species: Hu
Applications: BA
Publications for Syncollin Recombinant Protein (H00342898-P01) (0)
There are no publications for Syncollin Recombinant Protein (H00342898-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Syncollin Recombinant Protein (H00342898-P01) (0)
There are no reviews for Syncollin Recombinant Protein (H00342898-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Syncollin Recombinant Protein (H00342898-P01) (0)
Additional Syncollin Products
Bioinformatics Tool for Syncollin Recombinant Protein (H00342898-P01)
Discover related pathways, diseases and genes to Syncollin Recombinant Protein (H00342898-P01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Syncollin Recombinant Protein (H00342898-P01)
Discover more about diseases related to Syncollin Recombinant Protein (H00342898-P01).
| | Pathways for Syncollin Recombinant Protein (H00342898-P01)
View related products by pathway.
|
PTMs for Syncollin Recombinant Protein (H00342898-P01)
Learn more about PTMs related to Syncollin Recombinant Protein (H00342898-P01).
|
Blogs on Syncollin