Recombinant Human Syncollin GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Syncollin GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 134 of Human SYCN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYENCCGGAELSLESGADLPYLPSNWANTASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SYCN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
40.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Syncollin GST (N-Term) Protein

  • INSSA1
  • insulin synthesis associated 1
  • Insulin synthesis-associated protein 1
  • SYLFLJ27441
  • syncollin

Background

Syncollin functions in exocytosis in pancreatic acinar cells regulating the fusion of zymogen granules with each other.May have a pore-forming activity on membranes and regulate exocytosis in other exocrine tissues

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-595
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
NBP2-24535
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, Simple Western, Single-Cell Western, WB
NBP2-27393
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP1-32493
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86984
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NB120-6588
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PCR, WB
210-TA
Species: Hu
Applications: BA

Publications for Syncollin Recombinant Protein (H00342898-P01) (0)

There are no publications for Syncollin Recombinant Protein (H00342898-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syncollin Recombinant Protein (H00342898-P01) (0)

There are no reviews for Syncollin Recombinant Protein (H00342898-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syncollin Recombinant Protein (H00342898-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Syncollin Products

Bioinformatics Tool for Syncollin Recombinant Protein (H00342898-P01)

Discover related pathways, diseases and genes to Syncollin Recombinant Protein (H00342898-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syncollin Recombinant Protein (H00342898-P01)

Discover more about diseases related to Syncollin Recombinant Protein (H00342898-P01).
 

Pathways for Syncollin Recombinant Protein (H00342898-P01)

View related products by pathway.

PTMs for Syncollin Recombinant Protein (H00342898-P01)

Learn more about PTMs related to Syncollin Recombinant Protein (H00342898-P01).

Blogs on Syncollin

There are no specific blogs for Syncollin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Syncollin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCN