Recombinant Human Symplekin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Symplekin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-533 of Human SYMPK full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SYMPK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Symplekin Protein

  • FLJ27092
  • SPKSYM
  • symplekin

Background

SYMPK( AAH30214, 1 a.a. - 534 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP2-05680
Species: Hu
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-88049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
MAB6967
Species: Hu
Applications: WB
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008189-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Symplekin Recombinant Protein (H00008189-P01) (0)

There are no publications for Symplekin Recombinant Protein (H00008189-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Symplekin Recombinant Protein (H00008189-P01) (0)

There are no reviews for Symplekin Recombinant Protein (H00008189-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Symplekin Recombinant Protein (H00008189-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Symplekin Products

Bioinformatics Tool for Symplekin Recombinant Protein (H00008189-P01)

Discover related pathways, diseases and genes to Symplekin Recombinant Protein (H00008189-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Symplekin Recombinant Protein (H00008189-P01)

Discover more about diseases related to Symplekin Recombinant Protein (H00008189-P01).
 

Pathways for Symplekin Recombinant Protein (H00008189-P01)

View related products by pathway.

PTMs for Symplekin Recombinant Protein (H00008189-P01)

Learn more about PTMs related to Symplekin Recombinant Protein (H00008189-P01).

Blogs on Symplekin

There are no specific blogs for Symplekin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
Symplekin Antibody
NB100-74592

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Symplekin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYMPK