SUZ12 Antibody - BSA Free

Western Blot: SUZ12 Antibody [NBP2-33834] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

Immunocytochemistry/Immunofluorescence: SUZ12 Antibody [NBP2-33834] - Staining of human cell line HEK 293 shows localization to nucleoli & nuclear bodies. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SUZ12 Antibody [NBP2-33834] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: SUZ12 Antibody [NBP2-33834] - Staining of human tonsil shows weak nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: SUZ12 Antibody [NBP2-33834] - Staining of human small intestine shows weak nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SUZ12 Antibody [NBP2-33834] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUZ12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUZ12 Antibody - BSA Free (NBP2-33834) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPIT
• Predicted Species: Mouse (96%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUZ12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SUZ12 Protein (NBP2-33834PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SUZ12 Antibody - BSA Free

• ChET 9 protein
• CHET9
• CHET9polycomb protein SUZ12
• Chromatin precipitated E2F target 9 protein
• JJAZ1
• JJAZ1Joined to JAZF1 protein
• KIAA0160Suppressor of zeste 12 protein homolog
• suppressor of zeste 12 homolog (Drosophila)
• SUZ12

Background

This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. The specific function of this gene has not yet been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUZ12
• Uniprot:
  • Q15022()