SUSD2 Antibody

Images

 
Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUSD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUSD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SUSD2 Protein (NBP1-88589PEP)
Publications
Read Publications using
NBP1-88589 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25351403).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUSD2 Antibody

  • BK65A6.2
  • FLJ22778
  • SUSD2
  • Sushi domain (SCR repeat) containing
  • sushi domain containing 2
  • sushi domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32554
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45464
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB22441
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80220
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30042
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-88589
Species: Hu
Applications: IHC, IHC-P

Publications for SUSD2 Antibody (NBP1-88589)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SUSD2 Antibody (NBP1-88589) (0)

There are no reviews for SUSD2 Antibody (NBP1-88589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SUSD2 Antibody (NBP1-88589). (Showing 1 - 1 of 1 FAQs).

  1. Could you let me know concentration for the lot A40199 of NBP1-88589?
    • NBP1-88589, lot A40199, is supplied at 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional SUSD2 Products

Bioinformatics Tool for SUSD2 Antibody (NBP1-88589)

Discover related pathways, diseases and genes to SUSD2 Antibody (NBP1-88589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUSD2 Antibody (NBP1-88589)

Discover more about diseases related to SUSD2 Antibody (NBP1-88589).
 

Pathways for SUSD2 Antibody (NBP1-88589)

View related products by pathway.

PTMs for SUSD2 Antibody (NBP1-88589)

Learn more about PTMs related to SUSD2 Antibody (NBP1-88589).

Blogs on SUSD2

There are no specific blogs for SUSD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUSD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUSD2
Entrez