SUSD2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Analysis in human lung and liver tissues using NBP1-88589 antibody. Corresponding SUSD2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human lung shows high expression.

Immunohistochemistry-Paraffin: SUSD2 Antibody [NBP1-88589] - Staining of human liver shows low positivity in hepatocytes as expected.

Staining of human duodenum shows moderate membranous positivity in glandular and lymphoid cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUSD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUSD2 Antibody - BSA Free (NBP1-88589) is a polyclonal antibody validated for use in IHC. Anti-SUSD2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUSD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SUSD2 Protein (NBP1-88589PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUSD2 Antibody - BSA Free

• BK65A6.2
• FLJ22778
• SUSD2
• Sushi domain (SCR repeat) containing
• sushi domain containing 2
• sushi domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SUSD2 Antibody (NBP1-88589)(3)

Publications using NBP1-88589

• Bruikman C, Dalila N, van Capelleveen J et al. Genetic variants in SUSD2 are associated with the risk of ischemic heart disease Journal of Clinical Lipidology 2020-06-01 [PMID: 32620384] (IF/IHC, IHC-P, Human)
• Pan W, Cheng Y, Zhang H et al. CSBF/C10orf99, a novel potential cytokine, inhibits colon cancer cell growth through inducing G1 arrest. Sci Rep 2014-10-29 [PMID: 25351403] (IF/IHC, Human)
• Lindgren D, Bostrom AK, Nilsson K et al. Isolation and characterization of progenitor-like cells from human renal proximal tubules. Am J Pathol 2011-02-01 [PMID: 21281815]

FAQs for SUSD2 Antibody (NBP1-88589). (Showing 1 - 1 of 1 FAQs).

1. Could you let me know concentration for the lot A40199 of NBP1-88589?
   • NBP1-88589, lot A40199, is supplied at 0.2mg/ml.

Bioinformatics

• Gene Symbol: SUSD2