SUR-8 Antibody - BSA Free

Western Blot: SUR-8 Antibody [NBP2-88384] - Host: Rabbit. Target Name: SHOC2. Sample Tissue: Human Fetal Kidney. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SUR-8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUR-8 Antibody - BSA Free (NBP2-88384) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUR-8. Peptide sequence: NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHOC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SUR-8 Antibody - BSA Free

• KIAA0862FLJ60412
• Protein soc-2 homolog
• Protein sur-8 homolog
• SIAA0862
• soc-2 (suppressor of clear, C.elegans) homolog
• soc-2 suppressor of clear homolog (C. elegans)
• SOC-2
• SOC2SUR8leucine-rich repeat protein SHOC-2
• SUR-8

Background

Regulatory subunit of protein phosphatase 1 (PP1c) that acts as a M-Ras/MRAS effector and participates in MAPK pathway activation. Upon M-Ras/MRAS activation, targets PP1c to specifically dephosphorylate the 'Ser-259' inhibitory site of RAF1 kinase and stimulate RAF1 activity at specialized signaling complexes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHOC2