![Western Blot: SUPT7L Antibody [NBP2-57671] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.](http://images.novusbio.com/fullsize/SUPT7L-Antibody-Western-Blot-NBP2-57671-img0002.jpg "Western Blot: SUPT7L Antibody [NBP2-57671] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD |
| Predicted Species | Mouse (94%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUPT7L |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Immunocytochemistry_10939.jpg)
![ELISA Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_ELISA_22249.jpg)
![Western Blot Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Western_Blot_23415.jpg)
![Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0013.jpg)
![Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0014.jpg)
![Immunocytochemistry/ Immunofluorescence KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-2350-img0015.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SUPT7L Antibody (NBP2-57671)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUPT7L |
![Immunocytochemistry/Immunofluorescence: SUPT7L Antibody [NBP2-57671] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/SUPT7L-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57671-img0001.jpg "Immunocytochemistry/Immunofluorescence: SUPT7L Antibody [NBP2-57671] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.")
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Western_Blot_16698.jpg)
![Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Immunohistochemistry_17204.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")