![Western Blot: Suppression of Tumorigenicity 7 Antibody [NBP2-88380] - Host: Rabbit. Target Name: ST7. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/Suppression of Tumorigenicity 7 Antibody-Western Blot-NBP2-88380-img0001.jpg "Western Blot: Suppression of Tumorigenicity 7 Antibody [NBP2-88380] - Host: Rabbit. Target Name: ST7. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human Suppression of Tumorigenicity 7. Peptide sequence: LRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Suppression of Tumorigenicity 7 Antibody (NBP2-88380)Discover more about diseases related to Suppression of Tumorigenicity 7 Antibody (NBP2-88380).
| Pathways for Suppression of Tumorigenicity 7 Antibody (NBP2-88380)View related products by pathway.
|
PTMs for Suppression of Tumorigenicity 7 Antibody (NBP2-88380)Learn more about PTMs related to Suppression of Tumorigenicity 7 Antibody (NBP2-88380).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Syntenin 1 Antibody [NBP1-31136] - HeLa whole cell extracts and HeLa exosome extract (3.5 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Syntenin 1 antibody [N1], N-term (NBP1-31136). The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.](http://images.novusbio.com/images2/Syntenin-1-Antibody-Western-Blot-NBP1-31136-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: Syntenin 1 Antibody [NBP1-31136] - Confocal immunofluorescence analysis (Olympus FV10i) of paraformaldehyde-fixed HeLa, using Syntenin 1antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with (Red) at 1:2000.](http://images.novusbio.com/images2/Syntenin-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31136-img0011.jpg)
![Immunohistochemistry-Paraffin: Syntenin 1 Antibody [NBP1-31136] - Paraffin-embedded mouse liver. Syntenin 1 antibody [N1], N-term dilution: 1:500.](http://images.novusbio.com/images2/Syntenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-31136-img0005.jpg)
![Western Blot: ST5 Antibody [NBP2-85831] - WB Suggested Anti-ST5 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole Cell](http://images.novusbio.com/images2/ST5 Antibody-Western Blot-NBP2-85831-img0003.jpg)
![Immunohistochemistry-Paraffin: ST5 Antibody [NBP2-85831] - Rabbit Anti-ST5 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic, nucleus. Primary Antibody Concentration: N/A. Other Working Concentrations: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 - 2.0 sec](http://images.novusbio.com/images2/ST5-Antibody-Immunohistochemistry-Paraffin-NBP2-85831-img0002.jpg)
![Immunohistochemistry-Paraffin: ST5 Antibody [NBP2-85831] - Rabbit Anti-ST5 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue. Observed Staining: Cytoplasm in cardiomyocytes. Primary Antibody Concentration: N/A. Other Working Concentrations: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 - 2.0 sec](http://images.novusbio.com/images2/ST5-Antibody-Immunohistochemistry-Paraffin-NBP2-85831-img0001.jpg)
![Immunohistochemistry: PRMT5 Antibody (2H3) [NBP2-45394] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/PRMT5-Antibody-(2H3)-Immunohistochemistry-NBP2-45394-img0007.jpg)
![Immunohistochemistry: PRMT5 Antibody (2H3) [NBP2-45394] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/PRMT5-Antibody-(2H3)-Immunohistochemistry-NBP2-45394-img0001.jpg)
![Immunohistochemistry: PRMT5 Antibody (2H3) [NBP2-45394] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/PRMT5-Antibody-(2H3)-Immunohistochemistry-NBP2-45394-img0002.jpg)
![Western Blot: Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (JG36-18) [NBP2-76871] - Western blot analysis of SULT2A1 on mouse kidney tissue lysate using anti-SULT2A1 antibody at 1/1,000 dilution.](http://images.novusbio.com/images2/Cytosolic-Sulfotransferase-2A1-SULT2A1-Antibody-(JG36-18)-Western-Blot-NBP2-76871-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (JG36-18) [NBP2-76871] - ICC staining SULT2A1 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Cytosolic-Sulfotransferase-2A1-SULT2A1-Antibody-(JG36-18)-Immunocytochemistry-Immunofluorescence-NBP2-76871-img0003.jpg)
![Immunohistochemistry: Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (JG36-18) [NBP2-76871] - Immunohistochemical analysis of paraffin-embedded mouse liver tissue using anti-SULT2A1 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Cytosolic-Sulfotransferase-2A1-SULT2A1-Antibody-(JG36-18)-Immunohistochemistry-NBP2-76871-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/NHE6-SLC9A6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38877-img0003.jpg)
![Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Analysis in human cerebral cortex and liver tissues using NBP2-38877 antibody. Corresponding NHE6/SLC9A6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/NHE6-SLC9A6 Antibody-Immunohistochemistry-Paraffin-NBP2-38877-img0010.jpg)
![Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/images2/NHE6-SLC9A6-Antibody-Immunohistochemistry-Paraffin-NBP2-38877-img0004.jpg)
![SDS-Page: Recombinant Human Wnt-2 Protein [H00007472-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/images2/Recombinant-Human-Wnt-2-Protein-SDS-Page-H00007472-P01-img0002.jpg)
![Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.](http://images.novusbio.com/images2/MeCP2 Antibody-Western Blot-NB100-56326-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - This antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.](http://images.novusbio.com/images2/MeCP2-Antibody-Immunocytochemistry-Immunofluorescence-NB100-56326-img0003.jpg)
![Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Mouse liver tissue using this antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in the hepatocytes, kupffer cells, and in the endothelial cells of blood vessels.](http://images.novusbio.com/images2/MeCP2-Antibody-Immunohistochemistry-Paraffin-NB100-56326-img0007.jpg)
![Western Blot: MMP-11 Antibody (SN74-08) [NBP2-67670] - Analysis of MMP11 on 293T cell lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.](http://images.novusbio.com/images2/MMP-11-Antibody-(SN74-08)-Western-Blot-NBP2-67670-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: MMP-11 Antibody (SN74-08) [NBP2-67670] - Staining MMP11 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/MMP-11-Antibody-(SN74-08)-Immunocytochemistry-Immunofluorescence-NBP2-67670-img0007.jpg)
![Immunohistochemistry-Paraffin: MMP-11 Antibody (SN74-08) [NBP2-67670] - Analysis of paraffin-embedded mouse spleen tissue using anti-MMP11 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/MMP-11-Antibody-(SN74-08)-Immunohistochemistry-Paraffin-NBP2-67670-img0005.jpg)
![Western Blot: Testin Antibody [NBP1-87987] - Analysis using Anti-TES antibody NBP1-87987 (A) shows similar pattern to independent antibody NBP1-85072 (B).](http://images.novusbio.com/images2/Testin-Antibody-Western-Blot-NBP1-87987-img0021.jpg)
![Immunocytochemistry/Immunofluorescence: Testin Antibody [NBP1-87987] - Staining of human cell line SiHa shows localization to cytosol & focal adhesion sites. Antibody staining is shown in green.](http://images.novusbio.com/images2/Testin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87987-img0012.jpg)
![Immunohistochemistry-Paraffin: Testin Antibody [NBP1-87987] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/images2/Testin-Antibody-Immunohistochemistry-Paraffin-NBP1-87987-img0025.jpg)
![Western Blot: Wnt-2b Antibody (JB48-34) [NBP2-75713] - Analysis of Wnt2b on SiHa cell lysates using anti-Wnt2b at 1/500 dilution.](http://images.novusbio.com/images2/Wnt-2b-Antibody-(JB48-34)-Western-Blot-NBP2-75713-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Wnt-2b Antibody (JB48-34) [NBP2-75713] - Staining Wnt2b in SHSY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Wnt-2b-Antibody-(JB48-34)-Immunocytochemistry-Immunofluorescence-NBP2-75713-img0004.jpg)
![Immunohistochemistry-Paraffin: Wnt-2b Antibody (JB48-34) [NBP2-75713] - Analysis of paraffin-embedded rat testis tissue using anti-Wnt2b antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Wnt-2b-Antibody-(JB48-34)-Immunohistochemistry-Paraffin-NBP2-75713-img0007.jpg)
![Immunohistochemistry-Paraffin: FoxP2 Antibody [NB100-55411] - Staining of paraffin embedded Human Placenta. Antibody at 2.5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/FoxP2-Antibody-Immunohistochemistry-Paraffin-NB100-55411-img0005.jpg)
![Immunohistochemistry-Paraffin: FoxP2 Antibody [NB100-55411] - Human prostate. Antibody at 2.5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/FOXP2 Antibody-Immunohistochemistry-Paraffin-NB100-55411-img0003.jpg)