Suppression of Tumorigenicity 7 Antibody

Images

 
Western Blot: Suppression of Tumorigenicity 7 Antibody [NBP2-88380] - Host: Rabbit. Target Name: ST7. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Suppression of Tumorigenicity 7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human Suppression of Tumorigenicity 7. Peptide sequence: LRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Suppression of Tumorigenicity 7 Antibody

  • DKFZp762O2113
  • ETS7q
  • FAM4A
  • FAM4A1
  • family with sequence similarity 4, subfamily A, member 1
  • HELG
  • RAY1
  • SEN4
  • suppression of tumorigenicity 7 (breast)
  • suppressor of tumorigenicity 7 protein
  • TSG7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31136
Species: Hu, Mu, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-85831
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45394
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP2-76871
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67670
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-87987
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1734
Species: Hu
Applications: WB, IP
NBP2-75713
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-55411
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for Suppression of Tumorigenicity 7 Antibody (NBP2-88380) (0)

There are no publications for Suppression of Tumorigenicity 7 Antibody (NBP2-88380).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Suppression of Tumorigenicity 7 Antibody (NBP2-88380) (0)

There are no reviews for Suppression of Tumorigenicity 7 Antibody (NBP2-88380). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Suppression of Tumorigenicity 7 Antibody (NBP2-88380) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Suppression of Tumorigenicity 7 Products

Diseases for Suppression of Tumorigenicity 7 Antibody (NBP2-88380)

Discover more about diseases related to Suppression of Tumorigenicity 7 Antibody (NBP2-88380).
 

Pathways for Suppression of Tumorigenicity 7 Antibody (NBP2-88380)

View related products by pathway.

PTMs for Suppression of Tumorigenicity 7 Antibody (NBP2-88380)

Learn more about PTMs related to Suppression of Tumorigenicity 7 Antibody (NBP2-88380).

Blogs on Suppression of Tumorigenicity 7

There are no specific blogs for Suppression of Tumorigenicity 7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Suppression of Tumorigenicity 7 Antibody and receive a gift card or discount.