![Western Blot: SUNC1 Antibody [NBP1-89567] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/SUNC1-Antibody-Western-Blot-NBP1-89567-img0005.jpg "Western Blot: SUNC1 Antibody [NBP1-89567] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNFRQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUN3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB and IHC activity reported in the literature (PMID: 20587347). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NB600-1160-img0011.jpg)
-Immunocytochemistry-Immunofluorescence-NB600-1160-img0012.jpg)
-Western-Blot-NB600-1160-img0013.jpg)
-Western-Blot-NB500-317-img0003.jpg)
-Flow-Cytometry-NB500-317-img0012.jpg)
-ELISA-NB500-317-img0013.jpg)
-Immunohistochemistry-Paraffin-NBP3-16119-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP3-16119-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP3-16119-img0003.jpg)
-Western-Blot-NBP2-59946-img0001.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-59946-img0002.jpg)
| Publication using NBP1-89567 | Applications | Species |
|---|---|---|
| Lindskog C, Asplund A, Engkvist M et al. Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets. Discov Med 2010-06-01 [PMID: 20587347] |
Secondary Antibodies |
Isotype Controls |
Pathways for SUNC1 Antibody (NBP1-89567)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUN3 |
![Immunocytochemistry/Immunofluorescence: SUNC1 Antibody [NBP1-89567] - Staining of human cell line A-431 shows positivity in cytoplasm & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/SUNC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89567-img0006.jpg "Immunocytochemistry/Immunofluorescence: SUNC1 Antibody [NBP1-89567] - Staining of human cell line A-431 shows positivity in cytoplasm & the Golgi apparatus. Antibody staining is shown in green.")
-Immunohistochemistry-Paraffin-NBP2-59783-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-59783-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-59783-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")