SUNC1 Antibody

Images

 
Western Blot: SUNC1 Antibody [NBP1-89567] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: SUNC1 Antibody [NBP1-89567] - Staining of human cell line A-431 shows positivity in cytoplasm & the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUNC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNFRQILFLIEQIDVLKALLRDMKDGMDNNHNWNTHGDPVEDPDHTEEVSNLVN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB and IHC activity reported in the literature (PMID: 20587347).
Control Peptide
SUNC1 Protein (NBP1-89567PEP)
Publications
Read Publication using NBP1-89567.

Reactivity Notes

Human reactivity reported in the literature (PMID: 20587347).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUNC1 Antibody

  • MGC33329
  • Sad1 and UNC84 domain containing 1
  • Sad1 and UNC84 domain containing 3
  • Sad1/unc-84 domain-containing protein 1
  • SUN domain-containing protein 3
  • SUNC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13399
Species: Hu
Applications: IHC, IHC-P
NBP2-75696
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-91074
Species: Hu
Applications: IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-03711
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-76778
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-49175
Species: Hu
Applications: WB, IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
H00010713-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6667
Species: Mu
Applications: WB, IHC
NBP1-33589
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77281
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-1921
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-75679
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP3-03388
Species: Hu, Mu, Rt
Applications: WB
NBP2-47481
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for SUNC1 Antibody (NBP1-89567)(1)

Reviews for SUNC1 Antibody (NBP1-89567) (0)

There are no reviews for SUNC1 Antibody (NBP1-89567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUNC1 Antibody (NBP1-89567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUNC1 Products

Bioinformatics Tool for SUNC1 Antibody (NBP1-89567)

Discover related pathways, diseases and genes to SUNC1 Antibody (NBP1-89567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SUNC1 Antibody (NBP1-89567)

View related products by pathway.

Blogs on SUNC1

There are no specific blogs for SUNC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUNC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUN3