C7orf57 Antibody

Immunohistochemistry-Paraffin: C7orf57 Antibody [NBP1-91074] - Staining of human prostate shows low expression as expected.

Immunohistochemistry: C7orf57 Antibody [NBP1-91074] - Staining of human fallopian tube shows strong positivity in ciliated cells.

Immunohistochemistry-Paraffin: C7orf57 Antibody [NBP1-91074] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: C7orf57 Antibody [NBP1-91074] - Staining in human fallopian tube and prostate tissues using anti-C7orf57 antibody. Corresponding C7orf57 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

C7orf57 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C7ORF57
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  C7orf57 Protein (NBP1-91074PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C7orf57 Antibody

• chromosome 7 open reading frame 57

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C7ORF57