FGGY carbohydrate kinase domain containing Antibody (3B9)

Images

 
Western Blot: FGGY carbohydrate kinase domain containing Antibody (3B9) [H00055277-M04] - Analysis of expression in HeLa (Cat # L013V1).
Sandwich ELISA: FGGY carbohydrate kinase domain containing Antibody (3B9) [H00055277-M04] - Detection limit for recombinant GST tagged FGGY is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FGGY carbohydrate kinase domain containing Antibody (3B9) Summary

Immunogen
FLJ10986 (NP_060761, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIG
Specificity
FLJ10986 - hypothetical protein FLJ10986 (3B9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGGY
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGGY carbohydrate kinase domain containing Antibody (3B9)

  • EC 2.7.1
  • EC 2.7.1.-
  • FGGY carbohydrate kinase domain containing
  • FGGY carbohydrate kinase domain-containing protein
  • FLJ10986

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47481
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-91074
Species: Hu
Applications: IHC, IHC-P
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89567
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-2466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-33589
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04) (0)

There are no publications for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04) (0)

There are no reviews for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FGGY carbohydrate kinase domain containing Products

Bioinformatics Tool for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04)

Discover related pathways, diseases and genes to FGGY carbohydrate kinase domain containing Antibody (H00055277-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04)

Discover more about diseases related to FGGY carbohydrate kinase domain containing Antibody (H00055277-M04).
 

Pathways for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04)

View related products by pathway.

Research Areas for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04)

Find related products by research area.

Blogs on FGGY carbohydrate kinase domain containing

There are no specific blogs for FGGY carbohydrate kinase domain containing, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGGY carbohydrate kinase domain containing Antibody (3B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGGY
Entrez
Uniprot