![Western Blot: FGGY carbohydrate kinase domain containing Antibody (3B9) [H00055277-M04] - Analysis of expression in HeLa (Cat # L013V1).](http://images.novusbio.com/fullsize2/FGGY-carbohydrate-kinase-domain-containing-Antibody-(3B9)-Western-Blot-H00055277-M04-img0003.jpg "Western Blot: FGGY carbohydrate kinase domain containing Antibody (3B9) [H00055277-M04] - Analysis of expression in HeLa (Cat # L013V1).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3B9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | FLJ10986 (NP_060761, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIG |
| Specificity | FLJ10986 - hypothetical protein FLJ10986 (3B9) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | FGGY |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00055277-M04 | Applications | Species |
|---|---|---|
| Zeguo S, Rui Z, Xiao Z et al. LINE-1 promotes tumorigenicity and exacerbates tumor progression via stimulating metabolism reprogramming in non-small cell lung cancer. Mol Cancer. 2022-07-16 [PMID: 35842613] |
Secondary Antibodies |
Isotype Controls |
Research Areas for FGGY carbohydrate kinase domain containing Antibody (H00055277-M04)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: FGGY carbohydrate kinase domain containing Antibody (3B9) [H00055277-M04] - Detection limit for recombinant GST tagged FGGY is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/FGGY-carbohydrate-kinase-domain-containing-Antibody-(3B9)-Sandwich-ELISA-H00055277-M04-img0002.jpg "Sandwich ELISA: FGGY carbohydrate kinase domain containing Antibody (3B9) [H00055277-M04] - Detection limit for recombinant GST tagged FGGY is 1 ng/ml as a capture antibody.")
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
