SUMO2 Recombinant Protein Antigen

Images

 
There are currently no images for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SUMO2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUMO2.

Source: E.coli

Amino Acid Sequence: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SUMO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-46758. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SUMO2 Recombinant Protein Antigen

  • HSMT3
  • MGC117191
  • sentrin 2
  • Sentrin-2
  • small ubiquitin-like modifier 2
  • small ubiquitin-related modifier 2
  • SMT3 (suppressor of mif two 3, yeast) homolog 2
  • SMT3 homolog 2
  • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
  • SMT3 suppressor of mif two 3 homolog 2 (yeast)
  • SMT3A
  • SMT3B
  • SMT3H2
  • SUMO2
  • SUMO-2
  • SUMO3
  • SUMO-3
  • Ubiquitin-like protein SMT3A
  • ubiquitin-like protein SMT3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-03852
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-55474
Species: Hu
Applications: ICC/IF
NB600-1318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93337
Species: Hu, Mu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-77158
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-46758PEP
Species: Hu
Applications: AC

Publications for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP) (0)

There are no publications for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP) (0)

There are no reviews for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP)

Discover related pathways, diseases and genes to SUMO2 Recombinant Protein Antigen (NBP2-46758PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP)

Discover more about diseases related to SUMO2 Recombinant Protein Antigen (NBP2-46758PEP).
 

Pathways for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP)

View related products by pathway.

PTMs for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP)

Learn more about PTMs related to SUMO2 Recombinant Protein Antigen (NBP2-46758PEP).

Blogs on SUMO2.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

SUMO2 Antibody
NB100-56444

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SUMO2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMO2
Entrez