SUMO2 Antibody [Alexa Fluor® 532]

Images

 

Product Details

Summary
Product Discontinued
View other related SUMO2 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38006AF532
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SUMO2 Antibody [Alexa Fluor® 532] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3).

Sequence:
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUMO2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for SUMO2 Antibody [Alexa Fluor® 532]

  • HSMT3
  • MGC117191
  • sentrin 2
  • Sentrin-2
  • small ubiquitin-like modifier 2
  • small ubiquitin-related modifier 2
  • SMT3 (suppressor of mif two 3, yeast) homolog 2
  • SMT3 homolog 2
  • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
  • SMT3 suppressor of mif two 3 homolog 2 (yeast)
  • SMT3A
  • SMT3B
  • SMT3H2
  • SUMO2
  • SUMO-2
  • SUMO3
  • SUMO-3
  • Ubiquitin-like protein SMT3A
  • ubiquitin-like protein SMT3B

Background

Function: Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4; Subcellular location: Nucleus

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-812
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-56590
Species: Hu, Rt
Applications: ICC/IF, WB
NB100-56405
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NBP2-03852
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-68864
Species: Mu
Applications: PEP-ELISA, WB
H00026054-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB600-1318
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16858
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for SUMO2 Antibody (NBP3-38006AF532) (0)

There are no publications for SUMO2 Antibody (NBP3-38006AF532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO2 Antibody (NBP3-38006AF532) (0)

There are no reviews for SUMO2 Antibody (NBP3-38006AF532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUMO2 Antibody (NBP3-38006AF532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUMO2 Products

Research Areas for SUMO2 Antibody (NBP3-38006AF532)

Find related products by research area.

Blogs on SUMO2.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUMO2 Antibody [Alexa Fluor® 532] and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMO2