SUB1 Antibody - BSA Free

Western Blot: SUB1 Antibody [NBP3-38376] - Western blot analysis of various lysates using SUB1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: SUB1 Antibody [NBP3-38376] - Immunofluorescence analysis of A549 cells using SUB1 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.

Immunoprecipitation: SUB1 Antibody [NBP3-38376] - Immunoprecipitation analysis of 150 ug extracts of HL60 cells using 3 ug SUB1 antibody. Western blot was performed from the immunoprecipitate using SUB1 antibody at a dilution of 1:500.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUB1 Antibody - BSA Free (NBP3-38376) is a polyclonal antibody validated for use in WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human SUB1 (NP_006704.3).
  
  Sequence:
  MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUB1 Antibody - BSA Free

• activated RNA polymerase II transcription cofactor 4
• activated RNA polymerase II transcriptional coactivator p15
• MGC102747
• p15
• PC4p14P15
• Positive cofactor 4
• RPO2TC1
• SUB1 homolog (S. cerevisiae)
• SUB1 homolog

Background

PC4 is a multifunctional transcriptional coactivator that plays an important role in transcription, repair, and replication. PC4 interacts with general transcription factors, DNA repair factors, and mRNA processing factors to influence transcription initiation, coactivation, polyadenylation, transcription termination, and transcriptional repression. PC4 has been demonstrated to be a DNA binding protein and a bona fide component of chromatin with chromatin-compacting ability. Alternate names for PC4 include activated RNA polymerase II transcriptional coactivator p15, SUB1 homolog, positive cofactor 4, p14, SUB1, RPO2TC1, and MGC102747.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUB1