STRIP1 Antibody

Images

 
Western Blot: STRIP1 Antibody [NBP2-32528] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEK 293
Immunohistochemistry-Paraffin: STRIP1 Antibody [NBP2-32528] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STRIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VLLNIMYLIVETVHQECEGDKAEWRTMRQTFRAELGSPLYNNEPFAIMLFGMV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STRIP1 Protein (NBP2-32528PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STRIP1 Antibody

  • FAM40A
  • Family With Sequence Similarity 40, Member A
  • FAR11 Factor Arrest 11 Homolog A (Yeast)
  • FAR11 Factor Arrest 11 Homolog A
  • FAR11A
  • Homolog Of Yeast FAR11 Protein 1
  • KIAA1761
  • Protein FAM40A
  • Striatin Interacting Protein 1
  • Striatin-Interacting Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81435
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81397
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74571
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16479
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14535
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82151
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
AF4004
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB8494
Species: Hu
Applications: WB, IHC, ICC
NBP2-32528
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for STRIP1 Antibody (NBP2-32528) (0)

There are no publications for STRIP1 Antibody (NBP2-32528).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STRIP1 Antibody (NBP2-32528) (0)

There are no reviews for STRIP1 Antibody (NBP2-32528). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STRIP1 Antibody (NBP2-32528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STRIP1 Products

Diseases for STRIP1 Antibody (NBP2-32528)

Discover more about diseases related to STRIP1 Antibody (NBP2-32528).

Blogs on STRIP1

There are no specific blogs for STRIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STRIP1 Antibody and receive a gift card or discount.