STRAP Recombinant Protein Antigen

Images

 
There are currently no images for STRAP Recombinant Protein Antigen (NBP2-56502PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STRAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STRAP.

Source: E. coli

Amino Acid Sequence: IHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STRAP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56502.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STRAP Recombinant Protein Antigen

  • MAP activator with WD repeats
  • MAWDpt-wd
  • serine/threonine kinase receptor associated protein
  • serine-threonine kinase receptor-associated protein
  • UNR-interacting protein
  • UNRIPPT-WD
  • WD-40 repeat protein PT-WD

Background

The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-88518
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85341
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00079760-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
7754-BH/CF
Species: Hu
Applications: BA
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-04266
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00079833-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-77305
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-61760
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB

Publications for STRAP Recombinant Protein Antigen (NBP2-56502PEP) (0)

There are no publications for STRAP Recombinant Protein Antigen (NBP2-56502PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STRAP Recombinant Protein Antigen (NBP2-56502PEP) (0)

There are no reviews for STRAP Recombinant Protein Antigen (NBP2-56502PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STRAP Recombinant Protein Antigen (NBP2-56502PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy an antibody for STRAP (serine-threonine receptor associated protein) and was wondering if you had published references related to the use of your STRAP antibodies. My application would be for Western blot.
    • Unfortunately, we do not have any published references related to the use of our STRAP antibodies yet. The antibodies were tested and validated and the images published on our website are in house images. If you would like me to help you choose an antibody that would be the best choice for your purposes please let me know what species you are working with. I also wanted to mention our 100% <a href="http://www.novusbio.com/support/quality-assurance.html" target="_self">Novus Guarantee</a> to you. We guarantee that the antibody you will use will work in species and application we have validated it in. If you experience any troubles, we will be happy to troubleshoot with you. However, should we fail to resolve your problems we will refund your purchase or replace the antibody with a more appropriate substitute.

Additional STRAP Products

Array NBP2-56502PEP

Blogs on STRAP

There are no specific blogs for STRAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STRAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STRAP